TA341433 ZNF764 antibody

Rabbit Polyclonal Anti-ZNF764 Antibody

See related secondary antibodies

Search for all "ZNF764"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human ZNF764

Product Description for ZNF764

Rabbit anti Human ZNF764.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF764

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Zinc finger protein 764
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Molecular weight 45 kDa (408 aa)
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96H86
Immunogen:
A synthetic peptide located within the following region:
AA Sequence:
KKERQREGTGALEKPDPVAAGSPGLKSPQAPSAGPPYGWEQLSKAPHRGR
GeneID:
92595
Application Western blotting: 0.2 . 1.0 µg/ml.
Background ZNF764 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 7 C2H2-type zinc fingers and 1 KRAB domain. ZNF764 may be involved in transcriptional regulation.
Concentration 1.0 mg/ml after reconstitution
General Readings Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004).
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (tested):
Human

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF764 (2 products)

Catalog No. Species Pres. Purity   Source  

ZNF764

ZNF764 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZNF764

ZNF764 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ZNF764 (2 products)

Catalog No. Species Pres. Purity   Source  

MGC13138 Lysate

Western Blot: MGC13138 Lysate [NBL1-18245] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for ZNF764.
  Novus Biologicals Inc.

ZNF764 293T Cell Transient Overexpression Lysate(Denatured)

ZNF764 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn