TA341452 TGIF2LX antibody

Rabbit Polyclonal Anti-TGIF2LX Antibody

See related secondary antibodies

Search for all "TGIF2LX"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Guinea Pig, Human TGIF2LX

Product Description for TGIF2LX

Rabbit anti Canine, Guinea Pig, Human TGIF2LX.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TGIF2LX

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Homeobox protein TGIF2LX, TGF(beta)induced transcription factor 2-like protein, TGFB-induced factor 2-like protein X-linked, TGIF-like on the X, TGIFLX
Presentation Purified
Reactivity Can, GP, Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8IUE1
Immunogen:
The immunogen for anti-TGIF2LX antibody: synthetic peptide directed towards the middle region of human TGIF2LX. Synthetic peptide located within the following region: KVKVSVTSPSSPELVSPEEHADFSSFLLLVDAAVQRAAELELEKKQEPNP.
GeneID:
90316
Application WB
Background This gene encodes a member ofThe TALE/TGIF homeobox family of transcription factors. Testis-specific expression suggests thatThis gene may play a role in spermatogenesis. A homolog ofThis gene lies withinThe male specific region of chromosome Y, in a block of sequence that is thought to beThe result of a large X-to-Y transposition. [provided by RefSeq, Jul 2008].
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for TGIF2LX (6 products)

Catalog No. Species Pres. Purity   Source  

TGIF2LX (1-241, His-tag)

TGIF2LX Human Purified > 85 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

TGIF2LX (1-241, His-tag)

TGIF2LX Human Purified > 85 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

TGIF2LX

TGIF2LX Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TGIF2LX

TGIF2LX Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TGIF2LX

TGIF2LX Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TGIF2LX

TGIF2LX Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for TGIF2LX (2 products)

Catalog No. Species Pres. Purity   Source  

TGIF2LX 293T Cell Transient Overexpression Lysate(Denatured)

TGIF2LX 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

TGIF2LX overexpression lysate

TGIF2LX overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn