TA341465 ZNF511 antibody

Rabbit Polyclonal Anti-ZNF511 Antibody

See related secondary antibodies

Search for all "ZNF511"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human ZNF511

Product Description for ZNF511

Rabbit anti Human ZNF511.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF511

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Zinc finger protein 511
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NB15
Immunogen:
The immunogen for anti-ZNF511 antibody: synthetic peptide directed towards the middle region of human ZNF511. Synthetic peptide located within the following region: KPKKSRSPASAEAPGDSGERSEGEAMEICSEPVAASPAPAGERRIYRHRI.
GeneID:
118472
Application WB
Background May be involved in transcriptiol regulation.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF511 (4 products)

Catalog No. Species Pres. Purity   Source  

ZNF511

ZNF511 Human in vitro transl.
  Abnova Taiwan Corp.

ZNF511

ZNF511 Human in vitro transl.
  Abnova Taiwan Corp.

ZNF511

ZNF511 Human Purified
  Novus Biologicals Inc.

ZNF511

ZNF511 Human Purified
  Novus Biologicals Inc.

Positive controls for ZNF511 (2 products)

Catalog No. Species Pres. Purity   Source  

ZNF511 293T Cell Transient Overexpression Lysate(Denatured)

ZNF511 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ZNF511 overexpression lysate

ZNF511 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn