TA341467 ZNF585B antibody

Rabbit Polyclonal Anti-ZNF585B Antibody

See related secondary antibodies

Search for all "ZNF585B"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human ZNF585B

Product Description for ZNF585B

Rabbit anti Human ZNF585B.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF585B

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Zinc finger protein 585B
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q52M93
Immunogen:
The immunogen for anti-ZNF585B antibody: synthetic peptide directed towards the N terminal of human ZNF585B. Synthetic peptide located within the following region: RKIIGYKPASSQDQKIYSGEKSYECAEFGKSFTWKSQFKVHLKVPTGEKL.
GeneID:
92285
Application WB
Background May be involved in transcriptiol regulation.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF585B (2 products)

Catalog No. Species Pres. Purity   Source  

ZNF585B

ZNF585B Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZNF585B

ZNF585B Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ZNF585B (1 products)

Catalog No. Species Pres. Purity   Source  

ZNF585B overexpression lysate

ZNF585B overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn