TA341474 ZNF285 antibody

Rabbit Polyclonal Anti-ZNF285 Antibody

See related secondary antibodies

Search for all "ZNF285"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Human ZNF285

Product Description for ZNF285

Rabbit anti Canine, Human ZNF285.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF285

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ZNF285A, Zinc finger protein 285A
Presentation Purified
Reactivity Can, Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96NJ3
Immunogen:
The immunogen for anti-ZNF285A antibody: synthetic peptide directed towards the middle region of human ZNF285A. Synthetic peptide located within the following region: PYEFHEWPMGCKQSSDLPRYQKVSSGDKPYKCKECGKGFRRSSSLHNHHR.
GeneID:
26974
Application WB
Background May be involved in transcriptiol regulation.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF285 (1 products)

Catalog No. Species Pres. Purity   Source  

ZNF285 (full length, N-term HIS tag)

ZNF285 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

Positive controls for ZNF285 (1 products)

Catalog No. Species Pres. Purity   Source  

ZNF285 overexpression lysate

ZNF285 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn