TA341489 ZNF645 antibody

Rabbit Polyclonal Anti-ZNF645 Antibody

See related secondary antibodies

Search for all "ZNF645"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human ZNF645

Product Description for ZNF645

Rabbit anti Human ZNF645.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF645

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Zinc finger protein 645
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N7E2
Immunogen:
The immunogen for anti-ZNF645 antibody: synthetic peptide directed towards the N terminal of human ZNF645. Synthetic peptide located within the following region: MNKMPAGEQECEYNKEGKYYSKGVKLVRKKKKIPGYRWGDIKINIIGEKD.
GeneID:
158506
Application WB
Background This gene encodes a member ofThe zinc finger domain-containing protein family.This family member contains both a RING-type and a C2H2-type of zinc finger domain, and it may function as an E3 ubiquitin-protein ligase. Protein localization suggests a role in human sperm production and quality control. [provided by RefSeq, Aug 2011].
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for ZNF645 (1 products)

Catalog No. Species Pres. Purity   Source  

ZNF645 overexpression lysate

ZNF645 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn