TA341500 ZNF548 antibody

Rabbit Polyclonal Anti-ZNF548 Antibody

See related secondary antibodies

Search for all "ZNF548"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human ZNF548

Product Description for ZNF548

Rabbit anti Human ZNF548.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF548

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Zinc finger protein 548
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NEK5
Immunogen:
The immunogen for anti-ZNF548 antibody: synthetic peptide directed towards the N terminal of human ZNF548. Synthetic peptide located within the following region: VHMAEEIFTCMEGWKDLPATSCLLQHQGPQSEWKPYRDTEDREAFQTGQN.
GeneID:
147694
Application WB
Background May be involved in transcriptiol regulation.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF548 (2 products)

Catalog No. Species Pres. Purity   Source  

ZNF548

ZNF548 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZNF548

ZNF548 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ZNF548 (1 products)

Catalog No. Species Pres. Purity   Source  

ZNF548 293T Cell Transient Overexpression Lysate(Denatured)

ZNF548 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn