TA341505 ZNF550 antibody

Rabbit Polyclonal Anti-ZNF550 Antibody

See related secondary antibodies

Search for all "ZNF550"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human ZNF550

Product Description for ZNF550

Rabbit anti Human ZNF550.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF550

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Zinc finger protein 550
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q7Z398
Immunogen:
The immunogen for anti-ZNF550 antibody: synthetic peptide directed towards the N terminal of human ZNF550. Synthetic peptide located within the following region: LLVSLGDRAQVHTREPTTYPPVLSERAFLRGSLTLESSTSSDSRLGRARD.
GeneID:
162972
Application WB
Background May be involved in transcriptiol regulation.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for ZNF550 (1 products)

Catalog No. Species Pres. Purity   Source  

ZNF550 293T Cell Transient Overexpression Lysate(Denatured)

ZNF550 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn