TA341511 SSX6 antibody

Rabbit Polyclonal Anti-SSX6 Antibody

See related secondary antibodies

Search for all "SSX6"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human SSX6

Product Description for SSX6

Rabbit anti Human SSX6.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SSX6

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms SSXP2, Synovial sarcoma X breakpoint 6, dJ54B20.1
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q7RTT6
Immunogen:
The immunogen for anti-SSX6 antibody: synthetic peptide directed towards the middle region of human SSX6. Synthetic peptide located within the following region: IPKIMPEKPAEEGSDSKGVPEASGPQNDGKKLCPPGKASSSEKIHERSGP.
GeneID:
280657
Application WB
Background This gene belongs toThe family of highly homologous synovial sarcoma X (SSX) breakpoint proteins.These proteins may function as transcriptiol repressors.They are also capable of eliciting spontaneously humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. SSX1, SSX2 and SSX4 genes have been involved inThe t(X;18) translocation characteristically found in all synovial sarcomas.This gene is classified as a pseudogene because a splice donor inThe 3' UTR has changed compared to other family members, renderingThe transcript a candidate for nonsense-mediated mR decay (NMD). [provided by RefSeq, Aug 2009].
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn