TA341524 ZFP42 antibody

Rabbit Polyclonal Anti-ZFP42 Antibody

See related secondary antibodies

Search for all "ZFP42"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human ZFP42

TA341524

More Views

  • TA341524
  • TA341524

Product Description for ZFP42

Rabbit anti Human ZFP42.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZFP42

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms REX-1, REX1, Reduced expression protein 1, ZNF754, Zfp-42, Zinc finger protein 754
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96MM3
Immunogen:
The immunogen for anti-ZFP42 antibody: synthetic peptide directed towards the N terminal of human ZFP42. Synthetic peptide located within the following region: MSQQLKKRAKTRHQKGLGGRAPSGAKPRQGKSSQDLQAEIEPVSAVWALC.
GeneID:
132625
Application WB
Background Involved inThe reprogramming of X-chromosome ictivation duringThe acquisition of pluripotency. Required for efficient elongation of TSIX, a non-coding R antisense to XIST. Binds DXPas34 enhancer withinThe TSIX promoter. Involved in ES cell self-renewal.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ZFP42 (4 products)

Catalog No. Species Pres. Purity   Source  

ZFP42

ZFP42 Human Purified
  Abnova Taiwan Corp.

ZFP42

ZFP42 Human
  Abnova Taiwan Corp.

ZFP42

ZFP42 Human Purified
  Abnova Taiwan Corp.

ZFP42

ZFP42 Human
  Abnova Taiwan Corp.

Positive controls for ZFP42 (2 products)

Catalog No. Species Pres. Purity   Source  

ZFP42 293T Cell Transient Overexpression Lysate(Denatured)

ZFP42 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ZFP42 overexpression lysate

ZFP42 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn