TA341529 ZNF233 antibody

Rabbit Polyclonal Anti-ZNF233 Antibody

See related secondary antibodies

Search for all "ZNF233"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Rat ZNF233

Product Description for ZNF233

Rabbit anti Human, Rat ZNF233.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF233

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Zinc finger protein 233
Presentation Purified
Reactivity Hu, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A6NK53
Immunogen:
The immunogen for anti-ZNF233 antibody: synthetic peptide directed towards the middle region of human ZNF233. Synthetic peptide located within the following region: ERACKCDVYDKGFSQTSQLQAHQRGHSRDKTYKWEVSDRIFNRNSGLHQR.
GeneID:
353355
Application WB
Background May be involved in transcriptiol regulation.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn