TA341534 ZNF735 / ZNF735P antibody

Rabbit Polyclonal Anti-ZNF735 Antibody

See related secondary antibodies

Search for all "ZNF735 / ZNF735P"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human ZNF735 / ZNF735P

Product Description for ZNF735 / ZNF735P

Rabbit anti Human ZNF735 / ZNF735P.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF735 / ZNF735P

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Putative zinc finger protein 735, Zinc finger protein 735 pseudogene
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P0CB33
Immunogen:
The immunogen for Anti-ZNF735 antibody is: synthetic peptide directed towards the middle region of Human ZNF735. Synthetic peptide located within the following region: NTQNKIFQTHKCVKVFSKFSNSNRHNARYTGKKHLKCKKYGKSFCMFSHL.
GeneID:
730291
Application WB
Background May be involved in transcriptiol regulation.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn