TA341550 AKAP10 antibody

Rabbit Polyclonal Anti-AKAP10 Antibody

See related secondary antibodies

Search for all "AKAP10"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish AKAP10

TA341550

More Views

  • TA341550

Product Description for AKAP10

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish AKAP10.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for AKAP10

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms A kinase anchor protein 10 mitochondrial, D-AKAP-2, Dual specificity A kinase-anchoring protein 2, PRKA10, Protein kinase A-anchoring protein 10
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O43572
Immunogen:
The immunogen for anti-AKAP10 antibody: synthetic peptide directed towards the middle region of human AKAP10. Synthetic peptide located within the following region: ESLYQRTYAGKMTFGRVSDLGQFIRESEPEPDVRKSKGSMFSQAMKKWVQ.
GeneID:
11216
Application WB
Background This gene encodes a member ofThe A-kise anchor protein family. A-kise anchor proteins bind toThe regulatory subunits of protein kise A (PKA) and confineThe holoenzyme to discrete locations withinThe cell.The encoded protein is localized to mitochondria and interacts with bothThe type I and type II regulatory subunits of PKA. Polymorphisms inThis gene may be associated with increased risk of arrhythmias and sudden cardiac death. [provided by RefSeq, May 2012].
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for AKAP10 (4 products)

Catalog No. Species Pres. Purity   Source  

AKAP10

AKAP10 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

AKAP10

AKAP10 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

AKAP10

AKAP10 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

AKAP10

AKAP10 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for AKAP10 (2 products)

Catalog No. Species Pres. Purity   Source  

AKAP10 293T Cell Transient Overexpression Lysate(Denatured)

AKAP10 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

AKAP10 Lysate (Non-Denatured)

AKAP10 Lysate (Non-Denatured) Transient overexpression cell lysate was tested with Anti-AKAP10 antibody (H00011216-M04 ) by Western Blots.
  Abnova Taiwan Corp.
  • LinkedIn