TA341554 AKAP1 antibody

Rabbit Polyclonal Anti-AKAP1 Antibody

See related secondary antibodies

Search for all "AKAP1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human AKAP1

Product Description for AKAP1

Rabbit anti Human AKAP1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for AKAP1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms A kinase anchor protein 1 mitochondrial, A-kinase anchor protein 149 kDa, AKAP-1, AKAP149, Dual specificity A-kinase-anchoring protein 1, PRKA1, Protein kinase A-anchoring protein 1, Spermatid A-kinase anchor protein 84
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q92667
Immunogen:
The immunogen for anti-AKAP1 antibody: synthetic peptide directed towards the C terminal of human AKAP1. Synthetic peptide located within the following region: VPFSNGVLKGELSDLGAEDGWTMDAEADHSGVAAPPPGKRGTLITRCPGF.
GeneID:
8165
Application WB
Background The A-kise anchor proteins (AKAPs) are a group of structurally diverse proteins, which haveThe common function of binding toThe regulatory subunit of protein kise A (PKA) and confiningThe holoenzyme to discrete locations withinThe cell.This gene encodes a member ofThe AKAP family.The encoded protein binds to type I and type II regulatory subunits of PKA and anchorsThem toThe mitochondrion.This protein is speculated to be involved inThe cAMP-dependent sigl transduction pathway and in directing R to a specific cellular compartment. [provided by RefSeq, Jul 2008].
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for AKAP1 (2 products)

Catalog No. Species Pres. Purity   Source  

AKAP1

AKAP1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

AKAP1

AKAP1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for AKAP1 (3 products)

Catalog No. Species Pres. Purity   Source  

AKAP1 293T Cell Transient Overexpression Lysate(Denatured)

AKAP1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

AKAP1 Lysate

Western Blot: AKAP1 Lysate [NBL1-07424] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for AKAP1 Protein
  Novus Biologicals Inc.

AKAP1 overexpression lysate

AKAP1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn