TA341567 DDX6 antibody

Rabbit Polyclonal Anti-DDX6 Antibody

See related secondary antibodies

Search for all "DDX6"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish DDX6

Product Description for DDX6

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish DDX6.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for DDX6

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ATP-dependent RNA helicase DDX6, ATP-dependent RNA helicase p54, DDX-6, DEAD box protein 6, HLR2, Oncogene RCK, RCK
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P26196
Immunogen:
The immunogen for anti-DDX6 antibody: synthetic peptide directed towards the N terminal of human DDX6. Synthetic peptide located within the following region: KTLKLPPKDLRIKTSDVTSTKGNEFEDYCLKRELLMGIFEMGWEKPSPIQ.
GeneID:
1656
Application WB
Background This gene encodes a member ofThe DEAD box protein family.The protein is an R helicase found in P-bodies and stress granules, and functions in translation suppression and mR degradation. It is required for microR-induced gene silencing. Multiple altertively spliced variants, encodingThe same protein, have been identified. [provided by RefSeq, Mar 2012].
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for DDX6 (3 products)

Catalog No. Species Pres. Purity   Source  

DDX6

DDX6 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

DDX6

DDX6 Human in vitro transl.
  Abnova Taiwan Corp.

DDX6

DDX6 Human in vitro transl.
  Abnova Taiwan Corp.

Positive controls for DDX6 (1 products)

Catalog No. Species Pres. Purity   Source  

DDX6 Lysate

Western Blot: DDX6 Lysate [NBL1-09810] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for DDX6
  Novus Biologicals Inc.
  • LinkedIn