TA341585 FSBP antibody

Rabbit Polyclonal Anti-RAD54B Antibody

See related secondary antibodies

Search for all "FSBP"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat FSBP

TA341585

More Views

  • TA341585

Product Description for FSBP

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat FSBP.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for FSBP

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Fibrinogen silencer-binding protein
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O95073
Immunogen:
The immunogen for anti-RAD54B antibody: synthetic peptide directed towards the middle region of human RAD54B. Synthetic peptide located within the following region: NSLKPLSMSQLKQWKHFSGDHLNLTDPFLERITENVSFIFQNITTQATGT.
GeneID:
100861412
Application WB
IHC
Background The protein encoded byThis gene belongs toThe DEAD-like helicase superfamily. It shares similarity with Saccharomyces cerevisiae RAD54 and RDH54, both of which are involved in homologous recombition and repair of D.This protein binds to double-stranded D, and displays ATPase activity inThe presence of D.This gene is highly expressed in testis and spleen, which suggests active roles in meiotic and mitotic recombition. Homozygous mutations ofThis gene were observed in primary lymphoma and colon cancer. [provided by RefSeq, Jul 2008].
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for FSBP (2 products)

Catalog No. Species Pres. Purity   Source  

FSBP (1-299, His-tag)

FSBP Human Purified > 85 % by SDS - PAGE E. coli
0.25 mg / €820.00
  OriGene Technologies GmbH

FSBP (1-299, His-tag)

FSBP Human Purified > 85 % by SDS - PAGE E. coli
50 µg / €320.00
  OriGene Technologies GmbH
  • LinkedIn