TA341586 DDX25 antibody

Rabbit Polyclonal Anti-DDX25 Antibody

See related secondary antibodies

Search for all "DDX25"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat DDX25

Product Description for DDX25

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat DDX25.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for DDX25

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ATP-dependent RNA helicase DDX25, DEAD box protein 25, GRTH, Gonadotropin-regulated testicular RNA helicase
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UHL0
Immunogen:
The immunogen for anti-DDX25 antibody: synthetic peptide directed towards the middle region of human DDX25. Synthetic peptide located within the following region: ALQTGRVVEQMGKFCVDVQVMYAIRGNRIPRGTDITKQIIIGTPGTVLDW.
GeneID:
29118
Application WB
Background DEAD box proteins, characterized byThe conserved motif Asp-Glu-Ala-Asp (DEAD), are putative R helicases.They are implicated in a number of cellular processes involving alteration of R secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based onTheir distribution patterns, some members ofThe DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.This gene encodes a member ofThis family.The encoded protein is a godotropin-regulated and developmentally expressed testicular R helicase. It may serve to maintain testicular functions related to steroidogenesis and spermatogenesis. [provided by RefSeq, Jul 2008].
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for DDX25 (2 products)

Catalog No. Species Pres. Purity   Source  

DDX25

DDX25 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

DDX25

DDX25 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.
  • LinkedIn