TA341593 DDX46 antibody

Rabbit Polyclonal Anti-DDX46 Antibody

See related secondary antibodies

Search for all "DDX46"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat DDX46

Product Description for DDX46

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat DDX46.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for DDX46

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms DEAD box protein 46, KIAA0801, PRP5 homolog, Probable ATP-dependent RNA helicase DDX46
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q7L014
Immunogen:
The immunogen for anti-DDX46 antibody: synthetic peptide directed towards the middle region of human DDX46. Synthetic peptide located within the following region: LAEKINAKLNYVPLEKQEEERQDGGQNESFKRYEEELEINDFPQTARWKV.
GeneID:
9879
Application WB
Background This gene encodes a member ofThe DEAD box protein family. DEAD box proteins, characterized byThe conserved motif Asp-Glu-Ala-Asp (DEAD), are putative R helicases.They are implicated in a number of cellular processes involving alteration of R secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based onTheir distribution patterns, some members ofThis family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.The protein encoded byThis gene is a component ofThe 17S U2 snRNP complex; it plays an important role in pre-mR splicing. Multiple altertively spliced transcript variants have been found forThis gene. [provided by RefSeq, Jul 2014].
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for DDX46 (1 products)

Catalog No. Species Pres. Purity   Source  

DDX46 overexpression lysate

DDX46 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn