TA341598 DDX47 antibody

Rabbit Polyclonal Anti-DDX47 Antibody

See related secondary antibodies

Search for all "DDX47"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat DDX47

TA341598

Product Description for DDX47

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat DDX47.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for DDX47

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms DEAD box protein 47, Probable ATP-dependent RNA helicase DDX47
Presentation Purified
Reactivity Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H0S4
Immunogen:
The immunogen for anti-DDX47 antibody: synthetic peptide directed towards the N terminal of human DDX47. Synthetic peptide located within the following region: AAPEEHDSPTEASQPIVEEEETKTFKDLGVTDVLCEACDQLGWTKPTKIQ.
GeneID:
51202
Application WB
Background This gene encodes a member ofThe DEAD box protein family. DEAD box proteins, characterized byThe conserved motif Asp-Glu-Ala-Asp (DEAD), are putative R helicases.They are implicated in a number of cellular processes involving alteration of R secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based onTheir distribution patterns, some members ofThis family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.The protein encoded byThis gene can shuttle betweenThe nucleus andThe cytoplasm, and has an R-independent ATPase activity. Two altertively spliced transcript variants encoding distinct isoforms have been found forThis gene. [provided by RefSeq, Jul 2008].
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for DDX47 (3 products)

Catalog No. Species Pres. Purity   Source  

DDX47 (transcript variant 1)

DDX47 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

DDX47

DDX47 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

DDX47

DDX47 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for DDX47 (2 products)

Catalog No. Species Pres. Purity   Source  

DDX47 293T Cell Transient Overexpression Lysate(Denatured)

DDX47 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

DDX47 overexpression lysate

DDX47 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn