TA341607 DDX28 antibody

Rabbit Polyclonal Anti-DDX28 Antibody

See related secondary antibodies

Search for all "DDX28"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Human, Mouse, Porcine, Rat DDX28

Product Description for DDX28

Rabbit anti Bovine, Human, Mouse, Porcine, Rat DDX28.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for DDX28

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms DEAD box protein 28, MDDX28, Mitochondrial DEAD box protein 28, Probable ATP-dependent RNA helicase DDX28
Presentation Purified
Reactivity Bov, Hu, Ms, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NUL7
Immunogen:
The immunogen for anti-DDX28 antibody: synthetic peptide directed towards the N terminal of human DDX28. Synthetic peptide located within the following region: FSIERAQQEAPAVRKLSSKGSFADLGLEPRVLHALQEAAPEVVQPTTVQS.
GeneID:
55794
Application WB
Background DEAD box proteins, characterized byThe conserved motif Asp-Glu-Ala-Asp (DEAD), are putative R helicases.They are implicated in a number of cellular processes involving alteration of R secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based onTheir distribution patterns, some members ofThe DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.This gene is intronless. It encodes an R-dependent ATPase.The encoded protein is localized inThe mitochondria andThe nucleus, and can be transported betweenThe mitochondria andThe nucleus. [provided by RefSeq, Jul 2008].
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for DDX28 (2 products)

Catalog No. Species Pres. Purity   Source  

DDX28

DDX28 Human Purified
  Abnova Taiwan Corp.

DDX28

DDX28 Human Purified
  Abnova Taiwan Corp.

Positive controls for DDX28 (2 products)

Catalog No. Species Pres. Purity   Source  

DDX28 Lysate

Western Blot: DDX28 Lysate [NBL1-09791] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for DDX28
  Novus Biologicals Inc.

DDX28 overexpression lysate

DDX28 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn