TA341608 MOV10L1 antibody

Rabbit Polyclonal Anti-MOV10L1 Antibody

See related secondary antibodies

Search for all "MOV10L1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat MOV10L1

Product Description for MOV10L1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat MOV10L1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for MOV10L1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms MOV10-like 1, Moloney leukemia virus 10-like protein 1, Putative helicase Mov10l1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BXT6
Immunogen:
The immunogen for anti-MOV10L1 antibody: synthetic peptide directed towards the N terminal of human MOV10L1. Synthetic peptide located within the following region: LNVGQEVIAVVEENKVSNGLKAIRVEAVSDKWEDDSRNHGSPSDCGPRVL.
GeneID:
54456
Application WB
Background This gene is similar to a mouse gene that encodes a putative R helicase and shows testis-specific expression. Multiple transcript variants encoding different isoforms have been found forThis gene. [provided by RefSeq, Aug 2009].
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for MOV10L1 (2 products)

Catalog No. Species Pres. Purity   Source  

MOV10L1

MOV10L1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

MOV10L1

MOV10L1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for MOV10L1 (2 products)

Catalog No. Species Pres. Purity   Source  

MOV10L1 overexpression lysate

MOV10L1 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

MOV10L1 overexpression lysate

MOV10L1 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn