TA341609 DDX49 antibody

Rabbit Polyclonal Anti-DDX49 Antibody

See related secondary antibodies

Search for all "DDX49"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat, Yeast, Zebrafish DDX49

Product Description for DDX49

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat, Yeast, Zebrafish DDX49.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for DDX49

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms DEAD box protein 49, Probable ATP-dependent RNA helicase DDX49
Presentation Purified
Reactivity Can, Eq, GP, Hu, Ms, Por, Rt, Ye, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Y6V7
Immunogen:
The immunogen for anti-DDX49 antibody: synthetic peptide directed towards the N terminal of human DDX49. Synthetic peptide located within the following region: ELAYQIAEQFRVLGKPLGLKDCIIVGGMDMVAQALELSRKPHVVIATPGR.
GeneID:
54555
Application WB
Background The function of Anti-DDX49 has not yet been determined.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for DDX49 (3 products)

Catalog No. Species Pres. Purity   Source  

DDX49

DDX49 Human
  Abnova Taiwan Corp.

DDX49

DDX49 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.

DDX49

DDX49 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.

Positive controls for DDX49 (1 products)

Catalog No. Species Pres. Purity   Source  

DDX49 overexpression lysate

DDX49 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn