TA341611 DDX24 antibody

Rabbit Polyclonal Anti-DDX24 Antibody

See related secondary antibodies

Search for all "DDX24"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Mouse, Rat DDX24

Product Description for DDX24

Rabbit anti Human, Mouse, Rat DDX24.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for DDX24

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ATP-dependent RNA helicase DDX24, DEAD box protein 24
Presentation Purified
Reactivity Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9GZR7
Immunogen:
The immunogen for anti-DDX24 antibody: synthetic peptide directed towards the middle region of human DDX24. Synthetic peptide located within the following region: ELRHLLSQPLFTESQKTKYPTQSGKPPLLVSAPSKSESALSCLSKQKKKK.
GeneID:
57062
Application WB
Background DEAD box proteins, characterized byThe conserved motif Asp-Glu-Ala-Asp (DEAD), are putative R helicases.They are implicated in a number of cellular processes involving alteration of R secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based onTheir distribution patterns, some members ofThis family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.This gene encodes a DEAD box protein, which shows little similarity to any ofThe other known human DEAD box proteins, but shows a high similarity to mouse Ddx24 atThe amino acid level. [provided by RefSeq, Jul 2008].
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for DDX24 (5 products)

Catalog No. Species Pres. Purity   Source  

DDX24

DDX24 Human
  Abnova Taiwan Corp.

DDX24

DDX24 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.

DDX24

DDX24 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.

DDX24

DDX24 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

DDX24

DDX24 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for DDX24 (2 products)

Catalog No. Species Pres. Purity   Source  

DDX24 293T Cell Transient Overexpression Lysate(Denatured)

DDX24 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

DDX24 Lysate

Western Blot: DDX24 Lysate [NBL1-09789] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for DDX24
  Novus Biologicals Inc.
  • LinkedIn