TA341617 DHX35 antibody

Rabbit Polyclonal Anti-DHX35 Antibody

See related secondary antibodies

Search for all "DHX35"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat DHX35

Product Description for DHX35

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat DHX35.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for DHX35

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C20orf15, DDX35, DEAH box polypeptide 35, KAIA0875, Probable ATP-dependent RNA helicase DHX35
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H5Z1
Immunogen:
The immunogen for anti-DHX35 antibody: synthetic peptide directed towards the N terminal of human DHX35. Synthetic peptide located within the following region: MAAPVGPVKFWRPGTEGPGVSISEERQSLAENSGTTVVYNPYAALSIEQQ.
GeneID:
60625
Application WB
Background DEAD box proteins characterized byThe conserved motif Asp-Glu-Ala-Asp (DEAD), are putative R helicases.They are implicated in a number of cellular processes involving alteration of R secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based onTheir distribution patterns, some members ofThe DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.The function ofThis gene product which is a member ofThis family, has not been determined. Altertively spliced transcript variants have been found forThis gene. [provided by RefSeq, Jun 2010].
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for DHX35 (1 products)

Catalog No. Species Pres. Purity   Source  

DHX35

DHX35 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for DHX35 (2 products)

Catalog No. Species Pres. Purity   Source  

DHX35 overexpression lysate

DHX35 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

DHX35 overexpression lysate

DHX35 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn