TA341618 Helicard antibody

Rabbit Polyclonal Anti-IFIH1 Antibody

See related secondary antibodies

Search for all "Helicard"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Human, Mouse, Porcine, Rat Helicard

TA341618

More Views

  • TA341618
  • TA341618

Product Description for Helicard

Rabbit anti Bovine, Equine, Human, Mouse, Porcine, Rat Helicard.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for Helicard

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Helicase with 2 CARD domains, IFIH1, Interferon-induced helicase C domain-containing protein 1, MDA5, Melanoma differentiation-associated protein 5, Murabutide down-regulated protein, RH116, RNA helicase-DEAD box protein 116
Presentation Purified
Reactivity Bov, Eq, Hu, Ms, Por, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BYX4
Immunogen:
The immunogen for anti-IFIH1 antibody: synthetic peptide directed towards the middle region of human IFIH1. Synthetic peptide located within the following region: QINDTIRMIDAYTHLETFYNEEKDKKFAVIEDDSDEGGDDEYCDGDEDED.
GeneID:
64135
Application WB
IHC
Background DEAD box proteins, characterized byThe conserved motif Asp-Glu-Ala-Asp (DEAD), are putative R helicases.They are implicated in a number of cellular processes involving alteration of R secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based onTheir distribution patterns, some members ofThis family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.This gene encodes a DEAD box protein that is upregulated in response to treatment with beta-interferon and a protein kise C-activating compound, mezerein. Irreversible reprogramming of melanomas can be achieved by treatment with bothThese agents; treatment with either agent alone only achieves reversible differentiation. Genetic variation inThis gene is associated with diabetes mellitus insulin-dependent type 19. [provided by RefSeq, Jul 2012].
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Helicard (1 products)

Catalog No. Species Pres. Purity   Source  

Helicard

Helicard Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €788.00
  OriGene Technologies, Inc.

Positive controls for Helicard (2 products)

Catalog No. Species Pres. Purity   Source  

IFIH1 overexpression lysate

IFIH1 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

MDA5 Lysate

Western Blot: MDA5 Lysate [NBL1-11833] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for IFIH1
  Novus Biologicals Inc.
  • LinkedIn