TA341650 Annexin A3 / ANXA3 antibody

Rabbit Polyclonal Anti-ANXA3 Antibody

See related secondary antibodies

Search for all "Annexin A3 / ANXA3"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat Annexin A3 / ANXA3

Product Description for Annexin A3 / ANXA3

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat Annexin A3 / ANXA3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Annexin A3 / ANXA3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 2-cyclic phosphate 2-phosphohydrolase, 35-alpha calcimedin, ANX3, Annexin III, Annexin-3, Inositol 1, Lipocortin III, PAP-III, Placental anticoagulant protein III
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P12429
Immunogen:
The immunogen for anti-ANXA3 antibody: synthetic peptide directed towards the C terminal of human ANXA3. Synthetic peptide located within the following region: RIMVSRSEIDLLDIRTEFKKHYGYSLYSAIKSDTSGDYEITLLKICGGDD.
GeneID:
306
Application WB
Background This gene encodes a member ofThe annexin family. Members ofThis calcium-dependent phospholipid-binding protein family play a role inThe regulation of cellular growth and in sigl transduction pathways.This protein functions inThe inhibition of phopholipase A2 and cleavage of inositol 1,2-cyclic phosphate to form inositol 1-phosphate.This protein may also play a role in anti-coagulation. [provided by RefSeq, Jul 2008].
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Annexin A3 / ANXA3 (10 products)

Catalog No. Species Pres. Purity   Source  

Annexin A3 / ANXA3

Annexin A3 / ANXA3 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Annexin A3 / ANXA3 (1-323)

Recombinant human Annexin A3 (1-323 aa): 15% SDS-PAGE (3 µg) Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / €720.00
  OriGene Technologies GmbH

Annexin A3 / ANXA3 (1-323)

Recombinant human Annexin A3 (1-323 aa): 15% SDS-PAGE (3 µg) Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €290.00
  OriGene Technologies GmbH

Annexin A3 / ANXA3

Annexin A3 / ANXA3 Bovine Purified > 95 % Sequential chromatography of EGTA eluted Ca2+ -dependent membrane binding proteins by DEAE Sephacel, hydroxlapatite and Superose 12. Lung
  OriGene Technologies GmbH

Annexin A3 / ANXA3

Annexin A3 / ANXA3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Annexin A3 / ANXA3

Annexin A3 / ANXA3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Annexin A3 / ANXA3

SDS-Page: Annexin A3 Protein [NBP1-37072] - Annexin A3, 36.3 kDa (323aa), confirmed by MALDI-TOF with a purity of 90% by SDS - PAGE.
  Novus Biologicals Inc.

Annexin A3 / ANXA3 (1-323)

Human ANXA3 (Annexin A3) recombinant protein Human Purified > 95 % 10% SDS-PAGE stained with Coomassie Blue (CB), immunobloting with anti-6xHis monoclonal and peptide fingerprinting by MALDI-TOF mass spectrometry E. coli
  Protein Alternatives

Annexin A3 / ANXA3 (1-323)

Human ANXA3 (Annexin A3) recombinant protein Human Purified > 95 % 10% SDS-PAGE stained with Coomassie Blue (CB), immunobloting with anti-6xHis monoclonal and peptide fingerprinting by MALDI-TOF mass spectrometry E. coli
  Protein Alternatives

Annexin A3 / ANXA3 (1-323)

Human ANXA3 (Annexin A3) recombinant protein Human Purified > 95 % 10% SDS-PAGE stained with Coomassie Blue (CB), immunobloting with anti-6xHis monoclonal and peptide fingerprinting by MALDI-TOF mass spectrometry E. coli
  Protein Alternatives

Positive controls for Annexin A3 / ANXA3 (4 products)

Catalog No. Species Pres. Purity   Source  

Annexin A3 / ANXA3 Lysate(Denatured)

Annexin A3 / ANXA3 Lysate(Denatured)
  Abnova Taiwan Corp.

Annexin A3 / ANXA3 Lysate (Non-Denatured)

Annexin A3 / ANXA3 Lysate (Non-Denatured) Transient overexpression cell lysate was tested with Anti-ANXA3 antibody (H00000306-M12) by Western Blots.
  Abnova Taiwan Corp.

Annexin A3 Lysate

Western Blot: Annexin A3 Lysate [NBL1-07563] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ANXA3 Protein
  Novus Biologicals Inc.

ANXA3 overexpression lysate

ANXA3 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn