TA341658 Annexin A13 / ANXA13 antibody

Rabbit Polyclonal Anti-ANXA13 Antibody

See related secondary antibodies

Search for all "Annexin A13 / ANXA13"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat Annexin A13 / ANXA13

Product Description for Annexin A13 / ANXA13

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat Annexin A13 / ANXA13.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Annexin A13 / ANXA13

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ANX13, Annexin XIII, Annexin intestine-specific, Annexin-13, ISA
Presentation Purified
Reactivity Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P27216
Immunogen:
The immunogen for anti-ANXA13 antibody: synthetic peptide directed towards the N terminal of human ANXA13. Synthetic peptide located within the following region: EPEAPQPAKASSPQGFDVDRDAKKLNKACKGMGTNEAAIIEILSGRTSDE.
GeneID:
312
Application WB
Background This gene encodes a member ofThe annexin family. Members ofThis calcium-dependent phospholipid-binding protein family play a role inThe regulation of cellular growth and in sigl transduction pathways.The specific function ofThis gene has not yet been determined; however, it is associated withThe plasma membrane of undifferentiated, proliferating endothelial cells and differentiated villus enterocytes. Altertively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008].
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Annexin A13 / ANXA13 (8 products)

Catalog No. Species Pres. Purity   Source  

Annexin A13 / ANXA13 (transcript variant 1)

Annexin A13 / ANXA13 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Annexin A13 / ANXA13 (transcript variant 2)

Annexin A13 / ANXA13 Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
10 µg / €299.00
  OriGene Technologies, Inc.

Annexin A13 / ANXA13 (1-316, His-tag)

Annexin A13 / ANXA13 Human Purified > 90 % E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

Annexin A13 / ANXA13 (1-316, His-tag)

Annexin A13 / ANXA13 Human Purified > 90 % E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

Annexin A13 / ANXA13

Annexin A13 / ANXA13 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Annexin A13 / ANXA13

Annexin A13 / ANXA13 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Annexin A13 / ANXA13

Annexin A13 / ANXA13 Human Purified
  Novus Biologicals Inc.

Annexin A13 / ANXA13

Annexin A13 / ANXA13 Human Purified
  Novus Biologicals Inc.

Positive controls for Annexin A13 / ANXA13 (4 products)

Catalog No. Species Pres. Purity   Source  

ANXA13 293T Cell Transient Overexpression Lysate(Denatured)

ANXA13 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ANXA13 overexpression lysate

ANXA13 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

ANXA13 overexpression lysate

ANXA13 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

ANXA13 overexpression lysate

ANXA13 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn