TA341674 GJA9 / Cx58 antibody

Rabbit Polyclonal Anti-GJA9 Antibody

See related secondary antibodies

Search for all "GJA9 / Cx58"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Human GJA9 / Cx58

TA341674

More Views

  • TA341674
  • TA341674
  • TA341674

Product Description for GJA9 / Cx58

Rabbit anti Canine, Human GJA9 / Cx58.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for GJA9 / Cx58

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Connexin-58, Connexin-59, Cx59, GJA10, Gap junction alpha-10 protein, Gap junction alpha-9 protein
Presentation Purified
Reactivity Can, Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P57773
Immunogen:
The immunogen for anti-GJA9 antibody: synthetic peptide directed towards the middle region of human GJA9. Synthetic peptide located within the following region: IDGENNMRQSPQTVFSLPANCDWKPRWLRATWGSSTEHENRGSPPKGNLK.
GeneID:
81025
Application WB
Background Connexins, such as GJA9, are involved inThe formation of gap junctions, intercellular conduits that directly connectThe cytoplasms of contacting cells. Each gap junction channel is formed by docking of 2 hemichannels, each of which contains 6 connexin subunits (Sohl et al., 2003 [PubMed 12881038]).[supplied by OMIM, Mar 2008]. ##Evidence-Data-START## Transcript exon combition :: AL705385.1, AK312811.1 [ECO:0000332] Rseq introns :: single sample supports all introns ERS025094 [ECO:0000348] ##Evidence-Data-END##
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for GJA9 / Cx58 (1 products)

Catalog No. Species Pres. Purity   Source  

GJA9 / Cx58

GJA9 / Cx58 Human
  Abnova Taiwan Corp.

Positive controls for GJA9 / Cx58 (1 products)

Catalog No. Species Pres. Purity   Source  

GJA9 overexpression lysate

GJA9 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn