TA341681 GJC3 / Cx29 antibody

Rabbit Polyclonal Anti-GJC3 Antibody

See related secondary antibodies

Search for all "GJC3 / Cx29"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human GJC3 / Cx29

Product Description for GJC3 / Cx29

Rabbit anti Human GJC3 / Cx29.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for GJC3 / Cx29

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Connexin-29, GJE1, Gap junction epsilon-1 protein, Gap junction gamma-3 protein
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NFK1
Immunogen:
The immunogen for anti-GJC3 antibody: synthetic peptide directed towards the middle region of human GJC3. Synthetic peptide located within the following region: WHWELSGKGKEEETLIQGREGNTDVPGAGSLRLLWAYVAQLGARLVLEGAA.
GeneID:
349149
Application WB
Background This gene encodes a gap junction protein.The encoded protein, also known as a connexin, plays a role in formation of gap junctions, which provide direct connections between neighboring cells. Mutations inThis gene have been reported to be associated with nonsyndromic hearing loss.[provided by RefSeq, Feb 2010].
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for GJC3 / Cx29 (1 products)

Catalog No. Species Pres. Purity   Source  

GJC3 overexpression lysate

GJC3 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn