TA341692 MCM9 antibody

Rabbit Polyclonal Anti-MCM9 Antibody

See related secondary antibodies

Search for all "MCM9"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat MCM9

Product Description for MCM9

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat MCM9.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for MCM9

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C6orf61, DNA replication licensing factor MCM9, MCMDC1, Mini-chromosome maintenance deficient 9
Presentation Purified
Reactivity Bov, Can, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NXL9
Immunogen:
The immunogen for anti-MCM9 antibody: synthetic peptide directed towards the N terminal of human MCM9. Synthetic peptide located within the following region: NSDQVTLVGQVFESYVSEYHKNDILLILKERDEDAHYPVVVNAMTLFETN.
GeneID:
254394
Application WB
Background The protein encoded byThis gene is a member ofThe mini-chromosome maintence (MCM) protein family that are essential forThe initiation of eukaryotic genome replication. Binding ofThis protein to chromatin has been shown to be a pre-requisite for recruitingThe MCM2-7 helicase to D replication origins.This protein also binds, and is a positive regulator of,The chromatin licensing and D replication factor 1, CDT1. [provided by RefSeq, Nov 2010].
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for MCM9 (2 products)

Catalog No. Species Pres. Purity   Source  

MCM9

MCM9 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

MCM9

MCM9 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for MCM9 (1 products)

Catalog No. Species Pres. Purity   Source  

MCM9 overexpression lysate

MCM9 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn