TA341717 KCTD4 antibody

Rabbit Polyclonal Anti-KCTD4 Antibody

See related secondary antibodies

Search for all "KCTD4"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat KCTD4

Product Description for KCTD4

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat KCTD4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for KCTD4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms BTB/POZ domain-containing protein KCTD4
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8WVF5
Immunogen:
The immunogen for anti-KCTD4 antibody: synthetic peptide directed towards the middle region of human KCTD4. Synthetic peptide located within the following region: RSQGLRIFCNAPDFISKIKSRIVLVSKSRLDGFPEEFSISSNIIQFKYFI.
GeneID:
386618
Application WB
Background KCTD4 contains 1 BTB (POZ) domain.The exact function of KCTD4 remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for KCTD4 (5 products)

Catalog No. Species Pres. Purity   Source  

KCTD4

KCTD4 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

KCTD4 (1-259, His-tag)

KCTD4 Human Purified > 85 % by SDS - PAGE E. coli
0.1 mg / €820.00
  OriGene Technologies GmbH

KCTD4 (1-259, His-tag)

KCTD4 Human Purified > 85 % by SDS - PAGE E. coli
20 µg / €320.00
  OriGene Technologies GmbH

KCTD4

KCTD4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

KCTD4

KCTD4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for KCTD4 (1 products)

Catalog No. Species Pres. Purity   Source  

KCTD4 293T Cell Transient Overexpression Lysate(Denatured)

KCTD4 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn