SNAPC2 / SNAP45

Product Description for SNAPC2 / SNAP45

Rabbit anti Human SNAPC2 / SNAP45.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Product Category	Primary Antibodies
Quantity	0.1 ml
Synonyms	PSE-binding factor subunit delta, SNAP-45, SNAPc subunit 2, Small nuclear RNA-activating complex polypeptide 2, snRNA-activating protein complex subunit 2
Presentation	Purified
Reactivity	Hu
Applications	WB
Clonality	Polyclonal
Host	Rabbit
Isotype	IgG
Shipping to	Europe, USA/Canada
PDF datasheet	View Datasheet
Manufacturer	OriGene Technologies, Inc.

Immunogen	Swiss Prot Num: Q13487 Immunogen: The immunogen for Anti-SNAPC2 antibody is: synthetic peptide directed towards the C-terminal region of Human SNAPC2. Synthetic peptide located within the following region: EEDFAVDFEKIYKYLSSVSRSGRSPELSAAESAVVLDLLMSLPEELPLLP. GeneID: 6618
Application	WB
Background	This gene encodes a subunit ofThe snR-activating protein complex which is associated withThe TATA box-binding protein.The encoded protein is necessary for R polymerase II and III dependent small-nuclear R gene transcription. Altertive splicing results in multiple transcript variants. [provided by RefSeq, Nov 2009].
Format	Buffer System: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. State: Purified

Catalog No.	Species	Pres.	Purity	Source
TP304157	SNAPC2 / SNAP45
	Human		> 80 % Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps. Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.	HEK293 cells	20 µg / €748.00
					OriGene Technologies, Inc.
H00006618-P01-10	SNAPC2 / SNAP45
	Human	Purified	12.5% SDS-PAGE Stained with Coomassie Blue.
					Abnova Taiwan Corp.
H00006618-P01-25	SNAPC2 / SNAP45
	Human	Purified	12.5% SDS-PAGE Stained with Coomassie Blue.
					Abnova Taiwan Corp.
H00006618-Q01-10	SNAPC2 / SNAP45
	Human		12.5% SDS-PAGE Stained with Coomassie Blue.	in vitro transl.
					Abnova Taiwan Corp.
H00006618-Q01-25	SNAPC2 / SNAP45
	Human		12.5% SDS-PAGE Stained with Coomassie Blue.	in vitro transl.
					Abnova Taiwan Corp.

Catalog No.	Species
H00006618-T01	SNAPC2 293T Cell Transient Overexpression Lysate(Denatured)

		Abnova Taiwan Corp.
LY418914	SNAPC2 overexpression lysate
		0.1 mg / €295.00
		OriGene Technologies, Inc.

Catalog No.	Host	Pres.	React.	Applications
R1364AP	Rabbit IgG (H+L chain) antibody
	Goat	AP	Rb	E, WB
					OriGene Technologies GmbH
R1364B	Rabbit IgG (H+L chain) antibody
	Goat	Biotin	Rb	E, WB
					OriGene Technologies GmbH
R1364F	Rabbit IgG (H+L chain) antibody
	Goat	FITC	Rb	E, ICC/IF, WB
					OriGene Technologies GmbH
R1364HRP	Rabbit IgG (H+L chain) antibody
	Goat	HRP	Rb	E, P, WB
					OriGene Technologies GmbH
R1364T	Rabbit IgG (H+L chain) antibody
	Goat	TRITC	Rb	E, F, ICC/IF
					OriGene Technologies GmbH
R1427R	Rabbit IgG F(ab)2 Fragment (H+L chain) antibody
	Donkey	PE	Rb	F
					OriGene Technologies GmbH
R1458C2	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy2
					OriGene Technologies GmbH
R1458C3	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy3
					OriGene Technologies GmbH
R1458C5	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy5
					OriGene Technologies GmbH