TA341743 ALX4 antibody

Rabbit Polyclonal Anti-Alx4 Antibody

See related secondary antibodies

Search for all "ALX4"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat ALX4

Product Description for ALX4

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat ALX4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ALX4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Homeobox protein aristaless-like 4, KIAA1788
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H161
Immunogen:
The immunogen for anti-Alx4 antibody: synthetic peptide directed towards the middle region of mouse Alx4. Synthetic peptide located within the following region: EPELPPDSEPVGMDNSYLSVKETGAKGPQDRASAEIPSPLEKTDSESNKG.
GeneID:
60529
Application WB
Background Transcription factor involved in skull and limb development.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for ALX4 (1 products)

Catalog No. Species Pres. Purity   Source  

ALX4 overexpression lysate

ALX4 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn