TA341750 CIITA / C2TA antibody

Rabbit Polyclonal Anti-Ciita Antibody

See related secondary antibodies

Search for all "CIITA / C2TA"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Human, Mouse, Rat CIITA / C2TA

Product Description for CIITA / C2TA

Rabbit anti Canine, Human, Mouse, Rat CIITA / C2TA.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CIITA / C2TA

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms MHC class II transactivator, MHC2TA
Presentation Purified
Reactivity Can, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P79621
Immunogen:
The immunogen for anti-C2TA antibody: synthetic peptide directed towards the C terminal of mouse C2TA. Synthetic peptide located within the following region: MALWESLQQQGEAQLLQAAEEKFTIEPFKAKSPKDVEDLDRLVQTQRLRN.
GeneID:
12265
Application WB
Background Essential for transcriptiol activity ofThe HLA class II promoter; activation is viaThe proximal promoter. No D binding of in vitro translated CIITA was detected. May act in a coactivator-like fashion through protein-protein interactions by contacting factors binding toThe proximal MHC class II promoter, to elements ofThe transcription machinery, or both. Altertively it may activate HLA class II transcription by modifying proteins that bind toThe MHC class II promoter. Also mediates enhanced MHC class I transcription,The promoter element requirements for CIITA-mediated transcription are distinct from those of constitutive MHC class I transcription, and CIITA can functiolly replace TAF1 atThese genes. Exhibits intrinsic GTP-stimulated acetyltransferase activity. Exhibits serine/threonine protein kise activity: phosphorylatesThe TFIID component TAF7,The RAP74 subunit ofThe general transcription factor TFIIF, histone H2B at 'Ser-37' and other histones.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn