TA341756 EHF antibody

Rabbit Polyclonal Anti-Ehf Antibody

See related secondary antibodies

Search for all "EHF"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep EHF

TA341756

More Views

  • TA341756

Product Description for EHF

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep EHF.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for EHF

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ESE-3, ESE3, ESE3B, ESEJ, ETS domain-containing transcription factor, ETS homologous factor, Epithelium-specific Ets transcription factor 3, hEHF
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Sh
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NZC4
Immunogen:
The immunogen for anti-Ehf antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LFQSAHNVIVKTEQTDPSIMNTWKEENYLYDPSYGSTVDLLDSKTFCRAQ.
GeneID:
26298
Application WB
IHC
Background Ehf is a transcriptiol activator that may play a role in regulating epithelial cell differentiation and proliferation.Ehf may act as a repressor for a specific subset of ETS/AP-1-responsive genes, and as a modulator ofThe nuclear response to mitogen-activated protein kise sigling cascades.Ehf binds to D sequences containingThe consensus nucleotide core sequence GGAA.Ehf is involved in regulation of TNFRSF10B/DR5 expression through Ets-binding sequences onThe TNFRSF10B/DR5 promoter.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for EHF (7 products)

Catalog No. Species Pres. Purity   Source  

EHF (full length, N-term HIS tag, transcript variant 2)

EHF Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

EHF (1-300, His-tag)

EHF Human Purified > 90 % by SDS - PAGE E. coli
0.25 mg / €1,070.00
  OriGene Technologies GmbH

EHF (1-300, His-tag)

EHF Human Purified > 90 % by SDS - PAGE E. coli
50 µg / €400.00
  OriGene Technologies GmbH

EHF

EHF Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

EHF

EHF Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

EHF

EHF Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

EHF

EHF Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for EHF (3 products)

Catalog No. Species Pres. Purity   Source  

EHF 293T Cell Transient Overexpression Lysate(Denatured)

EHF 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

EHF Lysate

Western Blot: EHF Lysate [NBL1-10161] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for EHF.
  Novus Biologicals Inc.

EHF overexpression lysate

EHF overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn