TA341758 ELF3 / ESE-1 antibody

Rabbit Polyclonal Anti-Elf3 Antibody

See related secondary antibodies

Search for all "ELF3 / ESE-1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Mouse, Rat ELF3 / ESE-1

TA341758

More Views

  • TA341758

Product Description for ELF3 / ESE-1

Rabbit anti Mouse, Rat ELF3 / ESE-1.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for ELF3 / ESE-1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms E74-like factor 3, ERT, ESX, ETS-related transcription factor Elf-3, Elf-3, Epithelial-restricted with serine box, Epithelium-restricted Ets protein ESX, Epithelium-specific Ets transcription factor 1, JEN
Presentation Purified
Reactivity Ms, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q3UPW2
Immunogen:
The immunogen for anti-Elf3 antibody: synthetic peptide directed towards the N terminal of mouse Elf3. Synthetic peptide located within the following region: MAATCEISNVFSNYFNAMYSSEDPTLAPAPPTTFGTEDLVLTLNNQQMTL.
GeneID:
13710
Application WB
IHC
Background Elf3 is a transcriptiol activator that binds and transactivates ETS sequences containingThe consensus nucleotide core sequence GGA[AT]. It acts synergistically with POU2F3 to transactivateThe SPRR2A promoter and with RUNX1 to transactivateThe ANGPT1 promoter (By similarity). It also transactivates collagese, CCL20, CLND7, FLG, KRT8, NOS2, PTGS2, SPRR2B, TGFBR2 and TGM3 promoters. IT represses KRT4 promoter activity (By similarity). It may play an important role in epithelial cell differentiation and tumorigenesis and may be a critical downstream effector ofThe ERBB2 sigling pathway (By similarity). It may be associated with mammary gland development and involution. It plays an important role inThe regulation of transcription with TATA-less promoters in preimplantation embryos, which is essential in preimplantation development.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn