TA341760 ESX1 antibody

Rabbit Polyclonal Anti-ESX1 Antibody

See related secondary antibodies

Search for all "ESX1"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Mouse ESX1

Product Description for ESX1

Rabbit anti Mouse ESX1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ESX1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ESX1L, ESX1R, Homeobox protein ESX1
Presentation Purified
Reactivity Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O88933
Immunogen:
The immunogen for anti-ESX1 antibody: synthetic peptide directed towards the N terminal of mouse ESX1. Synthetic peptide located within the following region: MESHKKCPCCYCTDLKTFVGAVKEETLQDPQPSLSSTLLEGADYQENAES.
GeneID:
13984
Application WB
Background ESX1 is a homeobox gene related toThe mouse Esx1 homeobox gene. ESX1 is expressed during all stages of placental development and is localized to sparse areas of trophoblast in termil villi in association with cytotrophoblastic cells. Proteolytic processing of ESX1 plays a role in concerted regulation ofThe cell cycle and transcription in human cells.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn