TA341762 ETV2 / ER71 antibody

Rabbit Polyclonal Anti-Etv2 Antibody

See related secondary antibodies

Search for all "ETV2 / ER71"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Human, Mouse, Rat ETV2 / ER71

Product Description for ETV2 / ER71

Rabbit anti Canine, Human, Mouse, Rat ETV2 / ER71.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ETV2 / ER71

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ETS translocation variant 2, ETSRP71, Ets-related protein 71
Presentation Purified
Reactivity Can, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O00321
Immunogen:
The immunogen for anti-Etv2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: MDLWNWDEASLQEVPPGDKLTGLGAEFGFYFPEVALQEDTPITPMNVEGC.
GeneID:
2116
Application WB
Background Binds to D sequences containingThe consensus pentanucleotide 5'-CGGA[AT]-3'.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for ETV2 / ER71 (1 products)

Catalog No. Species Pres. Purity   Source  

ETV2 overexpression lysate

ETV2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn