TA341764 FOXD4 / FKHL9 antibody

Rabbit Polyclonal Anti-Foxd4 Antibody

See related secondary antibodies

Search for all "FOXD4 / FKHL9"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Mouse, Rat FOXD4 / FKHL9

Product Description for FOXD4 / FKHL9

Rabbit anti Mouse, Rat FOXD4 / FKHL9.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for FOXD4 / FKHL9

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms FOXD4A, FREAC5, Forkhead box protein D4, Forkhead-related protein FKHL9, Forkhead-related transcription factor 5, Myeloid factor-alpha
Presentation Purified
Reactivity Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q60688
Immunogen:
The immunogen for anti-Foxd4 antibody: synthetic peptide directed towards the N terminal of mouse Foxd4. Synthetic peptide located within the following region: MNSARAGHLRSTPPPSPLSSDQDEVEIDVLAEEEDGDQTEEEDDEEESHK.
GeneID:
14237
Application WB
Background The function ofThis protein remains unknown.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn