TA341769 FOXQ1 antibody

Rabbit Polyclonal Anti-Foxq1 Antibody

See related secondary antibodies

Search for all "FOXQ1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Mouse, Porcine, Rat FOXQ1

Product Description for FOXQ1

Rabbit anti Human, Mouse, Porcine, Rat FOXQ1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for FOXQ1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Forkhead box protein Q1, HFH-1, HFH1, HNF-3/forkhead-like protein 1, Hepatocyte nuclear factor 3 forkhead homolog 1
Presentation Purified
Reactivity Hu, Ms, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9C009
Immunogen:
The immunogen for anti-Foxq1 antibody: synthetic peptide directed towards the N terminal of mouse Foxq1. Synthetic peptide located within the following region: MKLEVFVPRAAHGDKMGSDLEGAGSSDVPSPLSAAGDDSLGSDGDCAANS.
GeneID:
94234
Application WB
Background The function ofThis protein remains unknown.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for FOXQ1 (5 products)

Catalog No. Species Pres. Purity   Source  

FOXQ1

FOXQ1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

FOXQ1

FOXQ1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

FOXQ1

FOXQ1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

FOXQ1

FOXQ1 Human
  Abnova Taiwan Corp.

FOXQ1

FOXQ1 Human
  Abnova Taiwan Corp.

Positive controls for FOXQ1 (1 products)

Catalog No. Species Pres. Purity   Source  

FOXQ1 overexpression lysate

FOXQ1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn