TA341773 FOXD1 / FKHL8 antibody

Rabbit Polyclonal Anti-FOXD1 Antibody

See related secondary antibodies

Search for all "FOXD1 / FKHL8"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Mouse, Rat FOXD1 / FKHL8

Product Description for FOXD1 / FKHL8

Rabbit anti Mouse, Rat FOXD1 / FKHL8.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for FOXD1 / FKHL8

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms FREAC4, Forkhead box protein D1, Forkhead-related protein FKHL8, Forkhead-related transcription factor 4
Presentation Purified
Reactivity Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q61345
Immunogen:
The immunogen for anti-FOXD1 antibody: synthetic peptide directed towards the N terminal of mouse FOXD1. Synthetic peptide located within the following region: TGAGTGGGAKNPLVKPPYSYIALITMAILQSPKKRLTLSEICEFISSRFP.
GeneID:
15229
Application WB
Background FOXD1 belongs toThe forkhead family of transcription factors which is characterized by a distinct forkhead domain. FOXD1, specifically activateThe 1b promoter ofThe RI alpha gene in testicular Sertoli cells.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn