TA341776 FOXA3 / HNF3G antibody

Rabbit Polyclonal Anti-Foxa3 Antibody

See related secondary antibodies

Search for all "FOXA3 / HNF3G"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat FOXA3 / HNF3G

Product Description for FOXA3 / HNF3G

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat FOXA3 / HNF3G.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for FOXA3 / HNF3G

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Fork head-related protein FKH H3, Forkhead box protein A3, HNF-3-gamma, HNF-3G, Hepatocyte nuclear factor 3-gamma, TCF3G, Transcription factor 3G
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P55318
Immunogen:
The immunogen for anti-Foxa3 antibody: synthetic peptide directed towards the c terminal of mouse Foxa3. Synthetic peptide located within the following region: YNFNHPFSINNLMSEQTSTPSKLDVGFGGYGAESGEPGVYYQSLYSRSLL.
GeneID:
3171
Application WB
Background Foxa3 is a transcription factor that is thought to act as a 'pioneer' factor openingThe compacted chromatin for other proteins through interactions with nucleosomal core histones andThereby replacing linker histones at target enhancer and/or promoter sites. Foxa3 is origilly described as a transcription activator for a number of liver genes such as AFP, albumin, tyrosine aminotransferase, PEPCK, etc. Foxa3 interacts withThe cis-acting regulatory regions ofThese genes.Foxa3 is involved in glucose homeostasis; activates GLUT2 transcription and regulation of neurol-specific transcription. Foxa3 is also involved in regulation of spermatogenesis; required forThe maintence ofThe testicular germ cell population and male fertility.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for FOXA3 / HNF3G (4 products)

Catalog No. Species Pres. Purity   Source  

FOXA3 / HNF3G

FOXA3 / HNF3G Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

FOXA3 / HNF3G

FOXA3 / HNF3G Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

FOXA3 / HNF3G

FOXA3 / HNF3G Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

FOXA3 / HNF3G

FOXA3 / HNF3G Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for FOXA3 / HNF3G (1 products)

Catalog No. Species Pres. Purity   Source  

FOXA3 293T Cell Transient Overexpression Lysate(Denatured)

FOXA3 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn