TA341779 HOXB13 antibody

Rabbit Polyclonal Anti-Hoxb13 Antibody

See related secondary antibodies

Search for all "HOXB13"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Guinea Pig, Human, Mouse, Rabbit, Rat HOXB13

Product Description for HOXB13

Rabbit anti Guinea Pig, Human, Mouse, Rabbit, Rat HOXB13.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for HOXB13

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Homeobox protein Hox-B13
Presentation Purified
Reactivity GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q92826
Immunogen:
The immunogen for anti-Hoxb13 antibody: synthetic peptide directed towards the n terminal of mouse Hoxb13. Synthetic peptide located within the following region: MEPGNYATLDGAKDIEGLLGAGGGRNLVSHSSPLASHPAAPTLMPTVNYA.
GeneID:
10481
Application WB
Background Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positiol identities onThe anterior-posterior axis.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for HOXB13 (7 products)

Catalog No. Species Pres. Purity   Source  

HOXB13 (1-284, His-tag)

HOXB13 Human Purified > 85 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

HOXB13 (1-284, His-tag)

HOXB13 Human Purified > 85 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

HOXB13

HOXB13 Human
  Abnova Taiwan Corp.

HOXB13

HOXB13 Human in vitro transl.
  Abnova Taiwan Corp.

HOXB13

HOXB13 Human in vitro transl.
  Abnova Taiwan Corp.

HOXB13

HOXB13 Human 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.

HOXB13

HOXB13 Human 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.
  • LinkedIn