TA341787 KLF2 antibody

Rabbit Polyclonal Anti-Klf2 Antibody

See related secondary antibodies

Search for all "KLF2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Mouse, Porcine, Rat KLF2

Product Description for KLF2

Rabbit anti Human, Mouse, Porcine, Rat KLF2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for KLF2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KLF2, Krueppel-like factor 2, LKLF, Lung krueppel-like factor
Presentation Purified
Reactivity Hu, Ms, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Y5W3
Immunogen:
The immunogen for anti-Klf2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: MALSEPILPSFATFASPCERGLQERWPRNEPEAGGTDEDLNNVLDFILSM.
GeneID:
10365
Application WB
Background Binds toThe CACCC box inThe beta-globin gene promoter and activates transcription.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for KLF2 (5 products)

Catalog No. Species Pres. Purity   Source  

KLF2

KLF2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

KLF2

KLF2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

KLF2

KLF2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

KLF2

KLF2 Human Purified
  Abnova Taiwan Corp.

KLF2

KLF2 Human 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for KLF2 (1 products)

Catalog No. Species Pres. Purity   Source  

KLF2 Lysate

Western Blot: KLF2 Lysate [NBL1-12319] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for KLF2
  Novus Biologicals Inc.
  • LinkedIn