TA341788 LHX5 antibody

Rabbit Polyclonal Anti-Lhx5 Antibody

See related secondary antibodies

Search for all "LHX5"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish LHX5

Product Description for LHX5

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish LHX5.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for LHX5

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms LHX5, LIM homeobox protein 5, LIM/homeobox protein Lhx5
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H2C1
Immunogen:
The immunogen for anti-Lhx5 antibody: synthetic peptide directed towards the middle region of mouse Lhx5. Synthetic peptide located within the following region: FFRSPRRMRPLGGRLDESEMLGSTPYTYYGDYQSDYYAPGGNYDFFAHGP.
GeneID:
64211
Application WB
Background Plays an essential role inThe regulation of neurol differentiation and migration during development ofThe central nervous system.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for LHX5 (2 products)

Catalog No. Species Pres. Purity   Source  

LHX5

LHX5 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

LHX5

LHX5 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for LHX5 (1 products)

Catalog No. Species Pres. Purity   Source  

LHX5 overexpression lysate

LHX5 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn