TA341789 LYL1 antibody

Rabbit Polyclonal Anti-Lyl1 Antibody

See related secondary antibodies

Search for all "LYL1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Mouse, Rat LYL1

Product Description for LYL1

Rabbit anti Mouse, Rat LYL1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for LYL1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms BHLHA18, Class A basic helix-loop-helix protein 18, Lymphoblastic leukemia-derived sequence 1, Protein lyl-1
Presentation Purified
Reactivity Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q66HH3
Immunogen:
The immunogen for Anti-Lyl1 antibody is: synthetic peptide directed towards the C-terminal region of Rat Lyl1. Synthetic peptide located within the following region: GVEGNARCGAGHRVEAARSQPVLPGDCDGDPNGSVRPIKMEQTALSPEVR.
GeneID:
304663
Application WB
Background The function ofThis protein remains unknown.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn