TA341793 Menin antibody

Rabbit Polyclonal Anti-Men1 Antibody

See related secondary antibodies

Search for all "Menin"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat Menin

Product Description for Menin

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat Menin.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Menin

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms MEN1, SCG2, multiple endocrine neoplasia I
Presentation Purified
Reactivity Bov, Eq, GP, Hu, Ms, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O00255
Immunogen:
The immunogen for anti-Men1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: YNYCREDEEIYKEFFEVANDVIPNLLKEAASLLETGEERTGEQAQGTQGQ.
GeneID:
4221
Application WB
Background Men1 may be involved in D repair. Men1 is a component of MLL-containing complexes (med MLL, ASCOM, MLL2/MLL3 or MLL3/MLL4 complex): at least composed ASH2L, RBBP5, DPY30, WDR5, one or several histone methyltransferases (MLL, MLL2, MLL3 and/or MLL4), andThe facultative components MEN1, HCFC1, HCFC2, NCOA6, KDM6A, PAXIP1/PTIP and C16orf53/PA1.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Menin (8 products)

Catalog No. Species Pres. Purity   Source  

Menin (transcript variant 2)

Menin Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Menin

Menin Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Menin

Menin Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Menin

Menin Human Purified
  Abnova Taiwan Corp.

Menin

Menin Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Menin

Menin Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Menin

Menin Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Menin

Menin Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for Menin (1 products)

Catalog No. Species Pres. Purity   Source  

MEN1 293T Cell Transient Overexpression Lysate(Denatured)

MEN1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn