TA341796 FOXD2 / FKHL17 antibody

Rabbit Polyclonal Anti-Foxd2 Antibody

See related secondary antibodies

Search for all "FOXD2 / FKHL17"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Rat FOXD2 / FKHL17

Product Description for FOXD2 / FKHL17

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Rat FOXD2 / FKHL17.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for FOXD2 / FKHL17

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms FREAC9, Forkhead box protein D2, Forkhead-related protein FKHL17, Forkhead-related transcription factor 9
Presentation Purified
Reactivity Bov, Eq, GP, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O60548
Immunogen:
The immunogen for anti-Foxd2 antibody: synthetic peptide directed towards the c terminal of mouse Foxd2. Synthetic peptide located within the following region: GPGGQAQVLAMLTAPALTPVAGHIRLSHPGDSLLSSGPSFASKVAGLSGC.
GeneID:
2306
Application WB
Background Foxd2 is a probable transcription factor involved in embryogenesis and somatogenesis.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for FOXD2 / FKHL17 (2 products)

Catalog No. Species Pres. Purity   Source  

FOXD2 / FKHL17

FOXD2 / FKHL17 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

FOXD2 / FKHL17

FOXD2 / FKHL17 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for FOXD2 / FKHL17 (1 products)

Catalog No. Species Pres. Purity   Source  

FOXD2 overexpression lysate

FOXD2 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn