PKMYT1

Product Description for PKMYT1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat PKMYT1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Product Category	Primary Antibodies
Quantity	0.1 ml
Synonyms	MYT1, Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase, Myt1 kinase
Presentation	Purified
Reactivity	Bov, Can, Eq, GP, Hu, Ms, Rt
Applications	WB
Clonality	Polyclonal
Host	Rabbit
Isotype	IgG
Shipping to	Europe, USA/Canada
PDF datasheet	View Datasheet
Manufacturer	OriGene Technologies, Inc.

Immunogen	Swiss Prot Num: Q99640 Immunogen: The immunogen for anti-Myt1 antibody: synthetic peptide directed towards the n terminal of mouse Myt1. Synthetic peptide located within the following region: VSKRKSHPLRLALDEGYRMDSDGSEDAEVKDVSVSDESEGPLEEAEAEMS. GeneID: 9088
Application	WB
Background	This gene is a member ofThe myelin transcription factor 1 gene family.The encoded protein, a zinc finger D-binding protein, is involved in regulation of oligodendrocyte differentiation and proliferation inThe developing central nervous system.The gene product has a role in remyelition through regeneration of oligodendrocyte lineage cells in response to demyelition. Altertive splicing results in multiple transcript variants. [provided by RefSeq, Jan 2010].
Format	Buffer System: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. State: Purified

Catalog No.	Species	Pres.	Purity	Source
TP322657	PKMYT1 (transcript variant 1)
	Human		> 80 % Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps. Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.	HEK293 cells	20 µg / €748.00
					OriGene Technologies, Inc.
H00009088-Q01-10	PKMYT1
	Human	Purified	12.5% SDS-PAGE Stained with Coomassie Blue.
					Abnova Taiwan Corp.
H00009088-Q01-25	PKMYT1
	Human	Purified	12.5% SDS-PAGE Stained with Coomassie Blue.
					Abnova Taiwan Corp.
P1358	PKMYT1
	Human
					Abnova Taiwan Corp.
P5606	PKMYT1
	Human
					Abnova Taiwan Corp.

Catalog No.	Species
H00009088-T01	PKMYT1 293T Cell Transient Overexpression Lysate(Denatured)

		Abnova Taiwan Corp.
NBL1-14463	PKMYT1 Lysate

		Novus Biologicals Inc.

Catalog No.	Host	Pres.	React.	Applications
R1364AP	Rabbit IgG (H+L chain) antibody
	Goat	AP	Rb	E, WB
					OriGene Technologies GmbH
R1364B	Rabbit IgG (H+L chain) antibody
	Goat	Biotin	Rb	E, WB
					OriGene Technologies GmbH
R1364F	Rabbit IgG (H+L chain) antibody
	Goat	FITC	Rb	E, ICC/IF, WB
					OriGene Technologies GmbH
R1364HRP	Rabbit IgG (H+L chain) antibody
	Goat	HRP	Rb	E, P, WB
					OriGene Technologies GmbH
R1364T	Rabbit IgG (H+L chain) antibody
	Goat	TRITC	Rb	E, F, ICC/IF
					OriGene Technologies GmbH
R1427R	Rabbit IgG F(ab)2 Fragment (H+L chain) antibody
	Donkey	PE	Rb	F
					OriGene Technologies GmbH
R1458C2	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy2
					OriGene Technologies GmbH
R1458C3	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy3
					OriGene Technologies GmbH
R1458C5	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy5
					OriGene Technologies GmbH