TA341799 Neogenin antibody

Rabbit Polyclonal Anti-Neo1 Antibody

See related secondary antibodies

Search for all "Neogenin"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Mouse Neogenin

Product Description for Neogenin

Rabbit anti Mouse Neogenin.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Neogenin

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Neo1, Ngn
Presentation Purified
Reactivity Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P97798
Immunogen:
The immunogen for Anti-Neo1 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Neo1. Synthetic peptide located within the following region: PPPPLLLLLPLLLLLGRPASGAAATKSGSPPQSAGASVRTFTPFYFLVEP.
GeneID:
18007
Application WB
Background The function ofThis protein remains unknown.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn